Search Tagsfor GrilledChickenTikka

grilicious_oldham

Grilicious Oldham

@grilicious_oldham


Comment from Grilicious Oldham:


garlicshredded grilledchickentikka griliciousoldham grilledlambchops Grilicious steak chickensteak yummy shreddedbbqchicken

18 Days ago
surrealeats

Grace Su ❤️ Food

@surrealeats


Comment from Grace Su ❤️ Food:


So this is what Indian fast food looks like. latenightatwork delivery postmates familystylemeal 5proteinsampler wait icount6 grilledchickentikka spinachpaneer chiligarliclambkeema malabarshrimpcurry chickentikkamasala chanamasala mangolassi californiachutney pasadena

19 Days ago
theoriginalemjay

MJ®

@theoriginalemjay


Comment from MJ®:


Had too much of a craving to not give in!! 🙈😂🍗🍟🍽 Rusholme GrilledChickenTikka HalfRice HalfChips Salad Sauces Rice Lunch Charcoal Grill Fresh Nice InstaFood Instalike Instapic Foodgasm Foodporn Delicious Scrumptious Halal Haloody Lovely Protein Crunchy Crisp Alhamdulillah AlTaiba Bukhari

48 Days ago
rolawalanorth

R O L A W A L A N O R T H

@rolawalanorth


Comment from R O L A W A L A N O R T H:


Thursday is ROLLING - This GrilledChickenTikka HERO Is how you do it, loaded with all the trimmings and no holding back on the MangoLime chutney either thursdaythriller indian streetfood leeds london epic eeeats food foodporn chicken spices rolawala trinitykitchen

75 Days ago
ritaskitchen_

Rita

@ritaskitchen_


Comment from Rita:


🤗FAT FRIDAY🤗 Feeling poorly today, 🤒🤕 didn't cook all day. Hubby got take out from grillhut mixed grill for supper tonight. mixedgrill grilledlambchops grilledchickentikka grilledlambsteaks grilledchickenwings spicy grillhut goodmayes notfeelingwell bemar comfortfood takeaway fridayistakeawayday takeout zaal food foodblogger foodography foodiegram instafoodblogger foodpics pakistanigrills indianfood spiceisnice ritaskitchen nocookingforme

81 Days ago
deerana1982

Deepa Rana

@deerana1982


Comment from Deepa Rana:


Tea today. grilledchickentikkaroastedpeppersroastedonionsroastedgarlic. Dee's and Seans own leanin15

196 Days ago
lilliput07

Lian Chua

@lilliput07


Comment from Lian Chua:


Dinner! softporktaco buffaloballs manukachevresalad grilledchickentikka squidfideua trufflemaccheroni prawnoystertempurawrap almondrhumcake triade saffronpannacotta redwinechocolatepudding saltedcaramelpotdecreme

222 Days ago
josephkeith

josephkeith

@josephkeith


Comment from josephkeith:


Grilled Chicken Tikka Masala chickentikka grilledchickentikka tikkamasala indianfood fusion chicken foodie foodporn foodphotography

223 Days ago
rolawalanorth

R O L A W A L A N O R T H

@rolawalanorth


Comment from R O L A W A L A N O R T H:


GrilledChickenTikka - the way we make it under500calories and still super juicy is pretty simple - an epic marinade loaded with spices, not oil - and never fried! Epic Indian Streetfood rolawala leeds meat chicken food foodporn foodstagram

244 Days ago
nazzy511

nazzy511

@nazzy511


Comment from nazzy511:


Lunchingricebowlgrilledchickentikkapickledonionsandshreddedcarrotsfriedonionsextrahotsauce😋

322 Days ago
bulwarkt

bulwarkt

@bulwarkt


Comment from bulwarkt:


this is happening 😉 chickentikka grilling grilledchickentikka

360 Days ago
homefoodfans

AJ

@homefoodfans


Comment from AJ:


Homefoodfans grilledchickentikka healthy onions bellpepper healthfood homemade foodforthought protein instapic instafood instagood instadaily food foodies foodfans yum yummy foodpron igersmuscat muscat middleeast foodlover

1 Years ago
moniisha_m

Monisha M

@moniisha_m


Comment from Monisha M:


food that makes you happy !! malaichickentikka rumaliroti chicken pakastani bundookhan grilled grilledchickentikka gastronomical gastronomicaldelight ilovefood instafood foodporn mobilephotography notaniphone nofilter instaupload instadaily igindia igersindia igramers latergram latenight hungerpangs happyme besties foodaddict foodie

1 Years ago
thewaheeed

W. Aslam

@thewaheeed


Comment from W. Aslam:


Back to desi food, for today only tho 😊😅 grilledchickentikka PakistaniBread beans bonappetite

1 Years ago
rishabvarma

Le Cordon Bleu

@rishabvarma


Comment from Le Cordon Bleu:


Health on a plate eggwhiteomelette grilledchickentikka sprouts tellthetrainer physicalfitness gettingfit oilfreecooking alyssachesson

1 Years ago
blendofspice

blendofspice

@blendofspice


Comment from blendofspice:


Yesterday's setup...can you tell I love BBQ's? We had Grilled Corn on the Cob, Quinoa Salad, Grilled Chicken Tikka and Jalapeño/Monetary Jack Burgers. What's your favorite BBQ side? BlendOfSpice BBQ GrillMaster MasterGriller Burgers ChickenTikka GrilledChickenTikka Corn CornOnTheCob Quinoa QuinoaSalad eeeeats f52gram foodography instafood foodgram GlutenFree MyKidLovesCowPrintCuzofToyStory CowPrint Woody

1 Years ago
munahjane

munah jane

@munahjane


Comment from munah jane:


The first pic is grilled chicken tikka, viazi karai, and salad. The second one I asked the guy who was making it what its called and he told me "pizza". Lol. I watched him make it. A soft dough that he spread like a square, and added to it a mixture of cooked minced meat, onions, Chilli and an egg. He spread this mixture on the dough, folded it, then layed it on a pan. I still think it should be named something else. I found it very interesting. inthestreetsofmombasa food foodie explore grilledchickentikka chickentikka salads pizza lol viazikarai iateallkindsoffoodthere eat igmeals igmombasa ignairobi

1 Years ago
levitaarries

Levita Arries

@levitaarries


Comment from Levita Arries:


My supper😊chickenaknigrilledchickentikkadrumstickyummymusclegainstonedbodycomingsoonexitedmuchfitmommyfitwifeyhealthylifehealthyhappywifehappylifemyfitnessjourneymyfitnesspal☺😊

1 Years ago
heidz5_7

heidz5_7

@heidz5_7


Comment from heidz5_7:


🍴 foodporn homecooking greekstyleveggies grilledchickentikka

1 Years ago
jtgdoha

jones the grocer Doha Qatar

@jtgdoha


Comment from jones the grocer Doha Qatar:


Jones Lunchbox sandwiches for dine in or takeaway! :) californiaclub turkeyandbrie wraps nicoise grilledchickentikka sandwichoftheday

1 Years ago