Search Tagsfor fit

ottolina_10

Carlottina

@ottolina_10


Comment from Carlottina:


"Completamente" Ph: Paolo Trigona Mua and hairstylist: Nuje Accademy vegan veganmodel vegansofig vegans fitness fitnessaddicted fit fitspiration fitnessmodel fitnessgirl fitnessmotivation fitspiration gym gymlife gymgirl gymaddict squatbooty bootybuilding bootylicious model models followme shooting shoot modeling modelshoot portrait

40 Seconds ago
imccp

💋啾啾愛亂拍💋

@imccp


Comment from 💋啾啾愛亂拍💋:


這間泳池拍起來美耶! bkk bangkok summer trip travel holiday vacation fit me happy photooftheday picoftheday followme twig love lover you smile couple together life today

41 Seconds ago
iran.f1tness

Bodybuilding & Fitness

@iran.f1tness


Comment from Bodybuilding & Fitness:


♻ حرکات اصلی رشد عضلات بازو 1️⃣پشت بازو هالتر از بالای سر 2️⃣جلو بازو هالتر 3️⃣پشت بازو دمبل خوابیده 4️⃣جلو بازو تناوبی 5️⃣پشت بازو تک دمبل خم 6️⃣جلو بازو لاری هالتر . ' . ' . ' بدنسازی سیکس پکاندام فیتنسپرورش اندام پرس سینهبرنامه تمرینیباشگاه کتف شانه ساعدمکمل ورزشی هالتر تمرین صحیح fit sport fitness sixpack bodybulding gym mucsle power power asiamucsle iranmucsle pack Proper training 🆔iran.f1tness

42 Seconds ago
imgod2you

KNEEL🔱

@imgod2you


Comment from KNEEL🔱:


The1IsNear Mood Music Martialarts Jiujitsu Fight Greenranger Amazing CA California LA LosAngeles Hiphop Swag Dance Fit Fitness Summer Beach Me Work Workout Motivation Dbz Ballislife Basketball Art Follow Followme Marvel

43 Seconds ago
dioxturkiye_

DİOX DETOX ÇAY

@dioxturkiye_


Comment from DİOX DETOX ÇAY:


"Ramazana girecegimiz şu donemde hepimizi fazla kilolarimiz ve bu kilolara daha fazla kilo eklenecegi korkusu sardi. Cunku ramazan ayinda ister istemez yemek duzenimizi degistiriyoruz ve ayari fazla kaciriyoruz. Ayriyetten yaz mevsimide oldugu icin giyimimizde degisiyor ve kendimizi rahat ve fit hissetmek istiyoruz. DIOX DETOX ile tum soru isaretlerinizi ve endiselerinizi cope atin cunku 1 ayda tam 6-9 kilo verebilecek ve istediginiz forma gelebileceksiniz"❤️👈😊🙏☝️☝️Takip Et diox tea form fit fitness fitnessmodel diyet diyetteyiz diet sağlık sagliklibeslenme saglikliyasam mutlu yemek kadin bayan indirim istanbul turkey deutschland austria europe ankara bursa izmir like instagram instalike life follow yemek follow

43 Seconds ago
sissylvk

Lia Victoria k

@sissylvk


Comment from Lia Victoria k:


Top 10 Enterizos & Jumpsuit mis favoritos _sheyoficial siempre Fashion sheylarojas sheyla shey blonde blondehair rubia perú peru peruvian modelo model top latina single soltera fit fitgirl fitness nopainnogain love queen enterizos jumpsuit ropa vestidos

44 Seconds ago
svitlana_shchedrina

Svitlana ◡̈ Shchedrina

@svitlana_shchedrina


Comment from Svitlana ◡̈ Shchedrina:


Some people are energy drainers, some are sick and toxic, and some are just downright rotten. The only thing that you can do is protect yourself and your loved ones. Order your favorite quote printed on a poster tshirt mug canvas throwpillow or tote The link is in bio. 😊 Enjoy ⚘ https://behappy.me/shchedrina motivation positivevibes inspiration fit goodenergy goodvibesonly quoteoftheday getinspired proverb zen sufi inspiration peace shchedrina optimistic instaquote success millionairemindset kindnessmatters gratitude determination successmindset instagood gogetit

45 Seconds ago
blasiangalmimi

blasiangalmimi

@blasiangalmimi


Comment from blasiangalmimi:


Truth! My 17 yr old body (20 years ago) is my body goal. 💪✨✨ model actor nomakeup teenager blasian naturalhairstyles actress naturalcurls pixiecut naturalhair blasian lingerie curlyhair fit blasians curls koreanandblack fitness bodygoals allnatural healthylifestyle healthyeating fit fitgang herbalife loseweightfast workout abs legday trainer body

46 Seconds ago
isap_galindo

isa galindo

@isap_galindo


Comment from isa galindo:


bae smile me cute tbt dance vsco gym selfie couple girls inspire billionaire asana fit money millionaire happy fametags ambition yoga workout android happy lovely fitness 2016 cash goals business fametags

46 Seconds ago
storm_performance24.7

Tyrone Milne

@storm_performance24.7


Comment from Tyrone Milne:


The daily grind!! The shirt says it all. Every day you miss puts you a day further from your goal or dream daily grind stronger everyday stormperformance muscle fitfam fitspo fitness fit strength conditioning weightloss power transform weights gym strong health training healthy invictus5 hardwork pt brisbanefit brisbanefitness eastbrisbane brisbane motivation progress

47 Seconds ago
mathieu_claustre

Mathieu Claustre

@mathieu_claustre


Comment from Mathieu Claustre:


💥pancake proteiné bulkpowders_fr + confiture de myrtille artisanale et fraises du jardin💥 eatclean healthyfood squadrunner run running runner mudrunguide bike teamshape fitness triathlon bodyfit crossfit fitfam fit ocr paleo fitfrench gym fitnessmotivation spartanrace trail eatclean nike nikerunning swimbikerun

47 Seconds ago
littlescanlon_chef

Benjamin Scanlon

@littlescanlon_chef


Comment from Benjamin Scanlon:


Hi Everyone, this weekend is my big step into my future 🚀. My step into my goals. My step into my belief. This weekend is the Climb for Cancer. It would mean a lot if you could support me by donating. http://www.fundraiseformater.org.au/BenScano Did you know that cancer is the leading cause of death in Australia? 1 in 2 Australians will be diagnosed with cancer before the age of 85. Thanks climbforcancer climbforcancer2017 fitness fit fitnessmotivation health healthylifestyle donations donation support cancer cancersupport motivationalquotes motivation lifegoals love stairs goals belief future chef cheffitness givingback

48 Seconds ago
ramona121283

🌸Mona '83🌸

@ramona121283


Comment from 🌸Mona '83🌸:


Guten Morgen ihr lieben, heute wird mit den Mädels eine Überraschung für den Vatertag vorbereitet oh wie sie sich freuen da wollten sie doch glatt nicht in den Kiga gehen 😂🙈😍😍 morgen wird mal wieder eine Geburtstagstorte gebacken 🎂 noch 3 Woooooochen und dann geht's ab nach Mallorca 🤗🤗☀️ habt alle einen schönen Tag 😍✌🏻 selfietimepicofthedayinstadailyinstagoodinstafitfitfitfamfitmomfitspofitnessfitnessmotivationstayfitgymgymgirlgymlifeinstainstapicinstagramhealthylifestylestrongstrongnotskinnyblackandwhitepichealthylifestylegirlmemyself

48 Seconds ago
unusualsavagebij

Julie Zova Steva

@unusualsavagebij


Comment from Julie Zova Steva:


We should cuddle naked. quotes quote asian ootd potd swag style igers photo instagood instadaily igdaily fashion ink fitness fit love model happy positive lgbt picoftheday girl photooftheday amazing smile like4like follow hair life

48 Seconds ago
sergo150.flowers_deliveries

Сергей Тарасов💐Dolce Vita

@sergo150.flowers_deliveries


Comment from Сергей Тарасов💐Dolce Vita:


Пионы большой выбор! Наш магазин цветов💐номера телефонов для заказов 89654688111 или 89654747678 Flowersmensphysique sergo_150 цветочныйфизикбмвсочи спортивныепарни спортивныедевушки сочи DAVIDCUP ifbb fit fitnesmotivation tarasovifbb menfizik men mensfitness магазинцветов sochibeach sochi тело DolceVita bmwmodus нормальноделайнормальнобудет мойстильжизни youfitsochi sochifornia менфизик summer цветы декор заказ магазин

49 Seconds ago
_janinenchen_

Janine

@_janinenchen_


Comment from Janine:


Idylle in Magdeburg 😊💕Guten morgen meine Lieben ...☀️🌹....auf in einen neuen informationsreichen Tag mit reichlich Power 💪🏻....Habt einen tollen Tag ( für viele der letzte Arbeitstag in der Woche 👍🏻😊) idylle animals germany schafe nature naturephotography myphotography myphoto photooftheday ziele erfolg bussiness networkmarketing gopro goprophotography mut leben gutenmorgen goodmorning beauty fit lifestyle magdeburg magdeburgcity mittwoch wednesday

50 Seconds ago
cami_danielle

C A M I _ D A N I E L L E

@cami_danielle


Comment from C A M I _ D A N I E L L E:


Bouncing around Isla islamujeres travel golfcart mexico hair makeup ootd pinup islandvibes islandlife fitness fit fitnessmotivation vegan veganlife vegansofinstagram yoga barre ebonyfitfreaks blackmagic flightattendant flightattendantlife

51 Seconds ago
s_ylll

박선영

@s_ylll


Comment from 박선영:


핫치킨mvp가 이렇게 맛있었다니...😱 . . . . . . 대구 동성로 경산 셀카 셀스타그램 얼스타그램 일상 소통 셀피 데일리 맞팔 선팔 좋아요 follow daily dailyphoto selfie selfies ootd f4f l4l 홍대 이태원 fit out outfit instagood 22

55 Seconds ago
cmharrison7

Chris Harrison

@cmharrison7


Comment from Chris Harrison:


Not sure about y'all but my haircuts double as a therapy session with nicholasapablasa Which usually result in us grabbing food or drinks afterwards. When I say I'm surrounded by beautiful people...I mean it. Literally. They're everywhere. So grateful. Finally feeling pretty again. Thanks boo!! 😘

1 Minutes ago
yponcee

Yesenia Ponce

@yponcee


Comment from Yesenia Ponce:


Touchdown! Back in Cali. One thing forsure is Cali will forever always have my heart, but being able to see different places around the world is honestly a blessing. Thank you Orlando for the amazing week. 🐊🌴☀️ ---------------------------------------------------------- HappyTuesday Travel Boss Confidence BuiltNotBought Motivation LegDay Booty WCW Fitness Fitnessgirls Inspire Grindtime Gainz Jeep JeepGirl Fitfam Fit Dedication Consistency Goals Passion FitChicks BootyGainz Squat Built Progress GirlsWithMuscles TeamCTN SheCanDoBoth

2 Minutes ago