Search Tagsfor gymshark

trainwithkflo

Kristina Flores

@trainwithkflo


Comment from Kristina Flores:


CORE CIRCUIT woooo I bet many people wanted a good core workout video my core was burning after this circuit In in out Leg raises w db Hip hip dolphins Squat crunch Repeat fitness fitnessmotivation fitnessgirl fitnesslover fitnessmodel gymshark gymmotivation gymlife gymtime gymwear gains💪 lit upperbodyworkout coreworkout strength hiitworkout hiitworkout inspired by gabbyschey wearing: gymshark

31 Seconds ago
dan_webb28

Daniel webb

@dan_webb28


Comment from Daniel webb:


So happy with the new new prints from nvr_performance_wear with the new B-Ball baseball style range available now. Check out nvr_performance_wear _ahealey fitfam baseball gymlife lift flex fitness gainz bodybuilding ripped gym beast training shredded muscle strong weights aesthetics inspiration motivation grind instafit gymaddict progress 9gag beastmode gymfashion physique fitnessaddict gymshark wearenvr

1 Minutes ago
_rooolinda_

_rooolinda_

@_rooolinda_


Comment from _rooolinda_:


No excuses 💪🏼 Train hard... noexcusestrainhardgohardorgohomebacksidepictureofthedaygymgirlgymsharkgymsharkofficialtrainingtattoolike4likebackfitnessmotivationfitnessgirlinstapicpictureofthedaymusclegirlswholift

1 Minutes ago
baki_duu

Fm 💪

@baki_duu


Comment from Fm 💪:


inked tattoo tatouage fitness workout crossfit musculation arms biceps triceps fit instafit streetworkout strength abs sixpack paris myprotein muscle bodybuilding shape paris militaire gymshark korea france like4like armee nanterre

1 Minutes ago
elizabethmorganfit

Elizabeth Aguilera

@elizabethmorganfit


Comment from Elizabeth Aguilera:


Morning ☀️ cardiodone trainingforvegas workout homeworkout train fitness healthylifestyle hiit christinesalusworkouts thankyouforkickingmyass lululemon vegan veganfitness florida toohottogooutside gymsharkwomen gymshark hungryaf

1 Minutes ago
wolverine86m

Orl@ndo1✨

@wolverine86m


Comment from Orl@ndo1✨:


Getting some breakfast this early morning..it's shoulders +legs today let's work..motivation follow4follow followforfollow wednesdays shoulders work workout training earlymorning believeinyourself music enjoyneversurrender nevergiveup keepgoing gym gymshark

1 Minutes ago
lu__.__

lu__.__

@lu__.__


Comment from lu__.__:


❤️body fitworld workout diet hardwork insta gain ifbb strong smile befit gymlife fit traning bodybulider trening eat myprotein abs sixpack fitness mass muscle fitbody instafit meal gymshark legsday happy gym

1 Minutes ago
fit_picture

Tag Us @fit_picture

@fit_picture


Comment from Tag Us @fit_picture:


Follow me, tag me, & like my pics to get noticed. Follow and add tag to photo fit_picture 📌Follow 👉🏻 aleksandraa_________ _ 💪🏻fitpicturefitfitnessgymmotivationselfieselfies goalsbodybodybuildingfitnessgoalsshape fitnessbodygoodvibesfitanne fitmom selfietimefitnessmangymsharkgymaddictfitspofitnessaddictfitnessfreakf4ffitnesswomenl4lfitboypolishgirlssunman

1 Minutes ago
style_me_to_the_moon

Ashleigh

@style_me_to_the_moon


Comment from Ashleigh:


😎📷 ___________________________________________________________________________________________________________________________ irishfitfam bodybuilding humpday ukfitfam vibes girlswholift pose igers bikiniprep fitspo instadaily irish nifma lift glutes growing provethemwrong strength hit instafit gymlife mood gap fitness biceps gymshark lifestyle thegym whysoserious mood

1 Minutes ago
amasiangains

Jimmy Nguyen

@amasiangains


Comment from Jimmy Nguyen:


Do what you love, and love what you do. • • • usarmymp japan mp thinblueline police bluefalcon bodybuilding mensphysique physique ocb ifbb InstaFit Fitfam fit fitness motivation fitnessmotivation dedication gains gymshark alphalete Alpha LVFT Livefit aesthetics aestheticrevolution asianetics

2 Minutes ago
thebrainhealthclub

The BrainHealth Club

@thebrainhealthclub


Comment from The BrainHealth Club:


Exercise, healthy nutrition habits, and cognitive training are the keys to optimal brain and body health! Call - 888-MINDGYM (646-3496) or email theexpertsthebrainhealthclub.com for improving and/or maintaining cognitive performance. Let The BrainHealth Club "UPGRADE YOUR MIND"

2 Minutes ago
thebrainhealthclub

The BrainHealth Club

@thebrainhealthclub


Comment from The BrainHealth Club:


Exercise, healthy nutrition habits, and cognitive training are the keys to optimal brain and body health! Call - 888-MINDGYM (646-3496) or email theexpertsthebrainhealthclub.com for improving and/or maintaining cognitive performance. Let The BrainHealth Club "UPGRADE YOUR MIND"

2 Minutes ago
thebrainhealthclub

The BrainHealth Club

@thebrainhealthclub


Comment from The BrainHealth Club:


Exercise, healthy nutrition habits, and cognitive training are the keys to optimal brain and body health! Call - 888-MINDGYM (646-3496) or email theexpertsthebrainhealthclub.com for improving and/or maintaining cognitive performance. Let The BrainHealth Club "UPGRADE YOUR MIND"

2 Minutes ago
brtsgtz

brtsgtz

@brtsgtz


Comment from brtsgtz:


Finslly my new bottle has arrived. gymsharkwomen gymshark gymaddict lovefitness behealthy makeyourgoals nobullshit waist gymlooks believeinyourself fit fitwomen fitnesslife

2 Minutes ago
agm_media

AGM Media

@agm_media


Comment from AGM Media:


Link In The Bio - Search " Squat " squats squat squatbooty Included. gymshark gym gymmemes gymmotivation gymlife gymselfie pickup pickuplines dating apple apparel fitness fitnessmotivation fitspo fitgirls fitgirl entrepreneur entrepreneurlifestyle millionaire

3 Minutes ago
agm_media

AGM Media

@agm_media


Comment from AGM Media:


Link In The Bio - Search " Squat " squats squat squatbooty Included. gymshark gym gymmemes gymmotivation gymlife gymselfie pickup pickuplines dating apple apparel fitness fitnessmotivation fitspo fitgirls fitgirl entrepreneur entrepreneurlifestyle millionaire

3 Minutes ago
cosima_rmn

Cosima Mercedes Reimann

@cosima_rmn


Comment from Cosima Mercedes Reimann:


gym fitness bodybuilding gymshark ultraboost

3 Minutes ago
emilyholl92

Emily Holland PRO

@emilyholl92


Comment from Emily Holland PRO:


The older I get, the more I realise negative people aren't necessary in your life. Positive vibes only 🙋🏻 New Versa Sports Bra, code below for you! ▫️▫️▫️▫️▫️▫️▫️▫️▫️▫️▫️▫️▫️▫️▫️▫️▫️ 🔹BPI Sports Athlete - EMH40 ▪️Versa Forma Athlete - EMILY15 🍗 MuscleFood UK Athlete - EHOLLAND1

3 Minutes ago
zeefitt

Zahid Ahmed

@zeefitt


Comment from Zahid Ahmed:


__________________________________________ aesthetic squat bench deadlift gym beastmode fit bodybuilding fat loseweịght powerlifting gains nutrition workout shredded transformation motivation abs cardio running martialarts yoga crossfit memes videos fight quotes fail quotes gymrat gymshark

3 Minutes ago
sharlynnooi

Sharlynn O. Zn

@sharlynnooi


Comment from Sharlynn O. Zn:


😻 This is one of my favourite snack esp when I'm craving for some good ol' nutella with more volume and lesser calories- Mix in 1tablespoon of Nutella into a cup of non-fat (greek) yogurt and add in additional toppings to suit your preferences!! I added sliced banana and some oats for zee crunch 🙆‍♀️💯 Think nutella yoghurt but packed w 2x the amount of protein and half the guilt 👌

9 Minutes ago