Search Tagsfor instafit

pvaldesb

Pedro Valdes

@pvaldesb


Comment from Pedro Valdes:


Good days to come! protein training transformation competitor food stronger aesthetics crossfit bcaa powerlifting active weightloss cardio fitfam isolate fitspiration beastmode gym ripped mindset eatclean fitnessaddict dreambody beforeafter shredded heavy train instafit muscles powerful

25 Seconds ago
homenslindos1

Homens Lindos ( Official ) 🔵

@homenslindos1


Comment from Homens Lindos ( Official ) 🔵:


Sigam meu gatão nieto5095 sexyboy sexyman muscle gym musculos men fitness fit fitnesslifestyle fitnesslife harrystyles gymtime gymlife bodybuilding polishboy puregym gymfreak trening instafit Beard bear Beards Bearded instacuerpos sexyguy gay guy instavideo instavideogay

28 Seconds ago
shantydee2007

ShantyDee🇨🇦

@shantydee2007


Comment from ShantyDee🇨🇦:


Ya, don't fool me lol 🍭 gains nevergiveup warrior thick fitchubbytoleanonedayatatime sweatsolid girlchubbyweightloss muscleinstafitfreeweightsgyminstathickarmyfitproteininstadailymindpowerofpersistenceconquerthick

39 Seconds ago
bbabes_world

The Most Sexy Girls

@bbabes_world


Comment from The Most Sexy Girls:


The model : allison.parker22 Follow bbabes_world ______ instafit motivation fit TFLers fitness gymlife pushpullgrind grindout flex instafitness gym trainhard eatclean grow sexy dedication strength ripped swole fitnessgear muscle shredded squat bigbench cardio sweat grind lifestyle pushpullgrind

40 Seconds ago
_autumnnnfit

Autumn Lindler

@_autumnnnfit


Comment from Autumn Lindler:


Sitting at work thumbing through pictures and stumbled across this gem.. 💎 Now I know why Peter Pan never wanted to grow up.. ✨ -

41 Seconds ago
nutricion.diego.reyes

Lic.Diego Reyes

@nutricion.diego.reyes


Comment from Lic.Diego Reyes:


Buenas noches... . En su debut en el Mr. Guayaquil. . ¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡¡1ER LUGAR!!!!!!!!!!!!!!!! . GANAMOS... TRABAJO EN EQUIPO. . GRACIAS A DIOS. . GRACIAS A MIS PADRES . GRACIAS ARGENTINA AMADA . mrguayaquil . Gracias chinoroberto, el trabajo en equipo tiene su recompensa!!!!. . Lic. Diego Reyes Nutricionista . Nutricionista crossfit bienestar nutrition instafit dietetico dieting dieta fitness argentina argentinas fitspiration fitness fitnessaddict foodporn gimnasio gym health workout getstrong instafit instagram instagood wod aesthetics sixpack eatclean shesquatbro abs 6pack

42 Seconds ago
danslazayifla

yoga dans workout

@danslazayifla


Comment from yoga dans workout:


dancingwithkids dancingwithmoms jazzdance shapeofyou danceworkout goodvibes instafit

43 Seconds ago
wickednrgsupps

WickedNRG

@wickednrgsupps


Comment from WickedNRG:


A common question we hear is can I use my fat burner as a pre-workout? The answer is yes, but why not try NDS Nutrition’s CARDIO CUTS?! New to wickednrgsupps, it’s formulated to be BOTH a pre-workout AND a thermogenic to assist with:⠀ .⠀ ✅ MAXIMUM ENERGY - includes caffeine, 100mg of Raspberry Ketones and KINETIQ™, a thermogenic-inducing blend to provide focus and to take your workout up a level!⠀ .⠀ ✅ GREATER ENDURANCE - with 1g of CarnoSyn® beta-alanine to build up your internal carnosine stores which acts as a buffer to lactic acid build up allowing you to train harder for longer.⠀ .⠀ ✅ QUICKER RECOVERY - packed with Glutamine, BCAAs and a rejuvenation complex to support recovery and repair.⠀ .⠀ ✅ WEIGHT LOSS - formulated with 500mg of CLA (Conjugated Linoleic Acid), 500mg of MCTs (Medium Chain Triglycerides), 1g of L-Carnitine and time-released caffeine.⠀ .⠀ In-store at Wicked NRG Stuart Park and Yarrawonga now! Both stores open 10am-4pm today.⠀ .⠀ wickednrg wickedsupps bestsuppsdarwin supplements preworkout fatburner cardio thermogenic workout fastedcardio ndsnutrition cardiocuts shredded fitness fitfam instafit workout results motivation darwin

45 Seconds ago
myra_fl

myra

@myra_fl


Comment from myra:


Leg Day 🏋🏻‍♀️🏋🏻‍♀️🏋🏻‍♀️ on Day 13. It was a pretty intense leg day. I'll be feeling the burn tomorrow for sure 😁. I did some front squats for first time as part of the workout. I've only tried them for a few reps before today. I think I like them. 💪 I'll go up in weight with them next time I do them. Today I was only front squatting the bar, getting used to the motion and exercise. Still staying on track with my eating. Tonight it will be a cheat of pizza 🍕😋😜 though. My goal is to not blow the hard work with eating like crap ALL weekend. So far so good 🤞 . . . . gymlife fitlife weightlossjourney fitfam healthlylifestyle progress motivated thickfit weightloss strong worthit igfitness instafit workout keepmoving girlswholift exercise backontrack motivation bepositive fitness progressnotperfection healthychanges mindset goals day13 legday

46 Seconds ago
jamesebullard

James Bullard

@jamesebullard


Comment from James Bullard:


Y'know what?! I believe I WILL be an amazing Bullard! Thanks, Team Pohlhammer! Love y'all! What a beautiful welcome back to the P.O.A. OWAN

52 Seconds ago
thembeasts

Sports & Viral Videos

@thembeasts


Comment from Sports & Viral Videos:


Mcgreger record knockout😱🔥 _ Follow thembeasts For More! Tag Friends!👥 footymb._ theufes . . . ~~~~~~~~~~~~~~~~~~~~~~~~ Ignore: instafit motivation fit socialenvy PleaseForgiveMe fitness gymlife pushpullgrind grindout flex instafitness gym trainhard eatclean grow focus dedication strength ripped swole fitnessgear muscle shredded squat cardio sweat grind lifestyle pushpullgrind

54 Seconds ago
luke_mc_22

L U K E M C C A B E

@luke_mc_22


Comment from L U K E M C C A B E:


i respect real women not children 👌  irishfitfam beastmode gym instafit fitnessaddict active bestoftheday instadaily fitnessfreak health healthylife eatclean twelveskip fitspo abs foodgasm lifestyle diet instahealth wellness getmoving

58 Seconds ago
rubendenardi

Ruben Denardi Team Trainer 🇦🇷

@rubendenardi


Comment from Ruben Denardi Team Trainer 🇦🇷:


ENTRENAMIENTO PRESENCIAL Y/O A DISTANCIA ✅ Descenso de peso ✅ Tonificación ✅ Aumento de masa muscular Consultas por mensaje privado ! PROGRAMAS -12 SEMANAS -24 SEMANAS ✔ Rutina de entrenamiento personalizada ✔ Plan de alimentación personalizado por una nutricionista/deportóloga ✔ Coaching 1a1 ✔ Contacto 24/7 Conseguí el objetivo que estás buscando ⚡⚡⚡ Más información en : Instagram : rubendenardi 💪 Twitter : ruben_1981 🐦 Mail : rubendenardi1981gmail.com 📩 12Weekprogram Fitnesscoach Tranformation Onlinetraining Elitefitness Mealplan Bulking Dedication Trainhard Coach Health Liftheavy Gymlife Protein Muscles Gains Shrededd Gym Motivation Men Menshealth Trainer Fit Life Fitness Cleanfood Eatclean Instafit Picoftheday Bodybuilding

1 Minutes ago
ghostfit16

Kyle

@ghostfit16


Comment from Kyle:


Back and forth 💪🏻 . . fit fitfam fitness summer travel motivation mood instafit sun instagood gay gayboy instagay gymlife gym work workout gainpost gains smile happy healthy gayguy life love training selfie beard nofilter muscle

1 Minutes ago
brian.c.tu

Brian Tu

@brian.c.tu


Comment from Brian Tu:


I think I'm seeing more definition haha that's why I have to take a saturdayselfie Got it done gains goals workout Pushed play noexcuses noregrets workoutselfie Insanity max 30  and 22 minute hard corps swole beachbody fitness weightloss kickassbody getfit fitfam instafit fit hardwork persistance progress dedication onedayatatime bettereveryday myjourney discipline progressnotperfection motivation perserverance weightlossjourney fitnessjourney like and follow my progress Sincerely the panda! 🐼

1 Minutes ago
gymgang_corp

GYM GANG

@gymgang_corp


Comment from GYM GANG:


Make sure you Go follow gymgang_corp MISSION: Changing the world 1 person at a time SLOGAN: Training is our religion PROGRESSION: Better than yesterday LIFESTYLE: Gym 🔗Gang GymGang GymGangvsObesity Gymgangornogang GymGangApparel GymGang4life PicOfTheDay Gym hellweek Physique bountytank PhotoOfTheDay Fitness Fit BodyBuilding doggcrap Motivation Nutrition stft Diet WeightLoss FatLoss Muscle Style Instafit Fitspiration Body Flex rec InstaDaily Workout

1 Minutes ago
belenppy

Ania

@belenppy


Comment from Ania:


Mi aNtEs y mI despUeS 😍😍😍 queReR eS podEr 💪💪 aL FiNal El sacRiFiCio y El eSfueRzo tiEnEn su reCompeNsa fitnesslife fitfam fitspo fitlife mododevida livehealthy livestylefitness quererespoder👊💪😃💖💖 newlife newgirl fitlover lovefitness power TOdo Se PuEdE cAmbiar instafit fitnessmotivation fitnessmodel fitnessblogger fitnessaddict

1 Minutes ago
_austinbatra

JUGGERNAUTBATRA

@_austinbatra


Comment from JUGGERNAUTBATRA:


JUGGERNAUTBATRA Fitness Gym YouTuber Workout Health instafit vancityfit vanfit VancouverFitness MenFitness MenHealth Active Boxing MMA Wrestling Jiujitsu MAMBAMMA TeamMamba BatFit1 BATRAFITNESS Shredded Abs MensHealth MensFitness Veins Hardwork Workout Training LoveIt KillIt

1 Minutes ago
kugukigiraga94

Suhendy

@kugukigiraga94


Comment from Suhendy:


First 10K run of the year 👍🏻 . . . . . . . . milorun2017 milointernational10kjakarta milo

2 Minutes ago
fitgainsbtch

Fitgainsbtch

@fitgainsbtch


Comment from Fitgainsbtch:


gym bodybuilding natural workout sweat muscles instafit fit fitness

6 Minutes ago