Search Tagsfor nopainnogain

arnaldocastelli

Arnaldo Castelli 🇮🇹

@arnaldocastelli


Comment from Arnaldo Castelli 🇮🇹:


A fundamental lesson nevergiveup nowayout nopainnogain noexuses jordan michaeljordan maimollare gym phrases life iphone6

31 Seconds ago
beneono

Béné Auneau

@beneono


Comment from Béné Auneau:


À notre changement de vie! 😁😍 ambition viesdesingue nopainnogain 💪🏻🍀❤

33 Seconds ago
edunogueirastudiopersonal

Trein. Físico Personalizado

@edunogueirastudiopersonal


Comment from Trein. Físico Personalizado:


... - Palavra do Senhor! ... - Graças à Deus!! O mestre sabe o que fala... 💪 Um ótimo Carnaval a todos. Bjs e abs. edunogueirapersonaltrainer personaltrainer gym fitness musculação treinamentofuncional functionaltraining wellness workout qualidadedevida lifestyle healthylife sports nopainnogain athlete academia ginástica vidasaudavel santos 013 zerotreze arnold arnoldschwarzenegger

34 Seconds ago
dar_fe_

dario ferlaino

@dar_fe_


Comment from dario ferlaino:


Buonanotte goodnight gymlife maniabarba nopainnogain madeinitaly trainingtime trainhard goodmorning beardgang beardlove beardman maniabarba tattoos septum bodybuilding fitnesslifestyle personaltrainer cosenza Calabria picoftheday igers gym barbershop barman lovefitness follow4follow lifestyle blackandwhite igerscosenza www.prozis.com/7fS

35 Seconds ago
juliagilasfanpage

Julia Gilas

@juliagilasfanpage


Comment from Julia Gilas:


Day to day the very best Julia Gilas photos for my fans! ☺️Follow me if you like the content☺️ ⚠️FITNESS MOTIVATION⚠️ . . . . . . . . physiquegirls muscleandhealth fitnesstips gymnastic fitgirlsrock fitlifestyle cardiotime workoutoftheday fitnessgear healthyoptions cardioflow fitgirlslift fitgirlsguide workoutshoes NoPainNoGain physiquetech healthyfoods muscletech fitgirlsruntheworld cardionight fitnessgoals workoutwednesday proteinwaffles fitgirlsgoiania fitfluential fitnessbloggen proteina musclegains physiqueofgreatness physiquelife

57 Seconds ago
samp049

Sam049

@samp049


Comment from Sam049:


Leg Day Max Out!! 295/1 Rep. 315/1 Rep. 335/2 Reps. Nuevo PR de Sentadilla imcrossfit nopainnogain justdoit squats perfection hardwork keeptraining nevergiveup focus lookforward neverlookback enoughsaid theperfectteam

1 Minutes ago
projeto_deboraoliver

Débora Raquel Oliver 🙆 🍽 📏🔒

@projeto_deboraoliver


Comment from Débora Raquel Oliver 🙆 🍽 📏🔒:


Tomo banho de lua... 🎶🌜🍃🍃🍃 ProjetoVidaSaudável ProjetoChoraInimigas EuQuero EuPosso EuConsigo Emagrecendo Emagrecer PorMim EuMeAmo VidaSaudável HábitosSaudáveis Treino Dieta Foco Determinação Superação Motivação Motivation Ouvercoming Superation NoPainNoGain FatOrFit LifeStyle InstaBlog InstaGood InstaFit GoGirl ObesityNot RioDeJaneiro Brasil

1 Minutes ago
ebbakarinelisabeth

Ebba Ohlsson

@ebbakarinelisabeth


Comment from Ebba Ohlsson:


Finally 😍😍 fightforfit fitness nocco moteeivateyourself gym nevergiveup minresaräknas tränahårthållkäft nopainnogain femimal nike aldrigvila fitspo tattoo abs girlswithtattoos motivation fitnessinspiration bootybuilding fitnessbutiken konditionsträning aldrigvila jagtogbeslutet abs fitnessaddict core cardio lohiloproteinglass lohilo

1 Minutes ago
javierpulido69

Javier Pulido

@javierpulido69


Comment from Javier Pulido:


Bueeeeno, hay que rematar el día con un pre-cama que parece un desayuno xD. Había que meter kcal fáciles, si no, no llegaba a mis kcal de hoy. Así que tiramos de galletas. . En total, han sido 4.200kcal. ¿Macros? 25%P - 55%HC - 20%G. Es decir: 260P - 575HC - 95G. Lo digo porque, luego, hay quien me lo pregunta. . Por cierto, BRUTAL la mantequilla de anacardos de prozis prozisespana. Es verdad lo que me habéis dicho todos: sabe a turrón blando, el de crema de almendras de toda la vida. ¡Vaya pelotazo! XD . Ración de vitamina C con el kiwi, y a sobar. De todos los cítricos, el que más vitamina C contiene. Las naranjas no son, ni por asomo, el alimento más rico en esta vitamina. . Dicho sea de paso, es la mejor opción para reforzar nuestro sistema inmunológico para los días de frío polar, además de ser un potente antioxidante (lo podéis encontrar como tal, con su otro nombre -ácido ascórbico- en botes de legumbres cocidas, por ejemplo), favorecer la cicatrización de heridas... . ¿Alimentos más ricos en vitamina C? Anotad: pimientos, brócoli, tomates, espinacas, fresas y kiwis. Frutos rojos y cítricos, en general, son buena fuente. ¡Vitaminízate! 💪 . Buenas noches! 😊 . PRE-CAMA: . 👉 Gachas de avena dulces: 70gr Copos de avena + Agua + Stevia + 200mL Claras de huevo (Topping: 5 Galletas María sin azúcares -30gr- + 30gr Mantequilla de Anacardos) . 👉 120gr Kiwi . 👉 Batido de helado napolitano: 15gr Proteína de concentrado de suero de leche sabor helado napolitano + 250mL Agua . Para ASESORAMIENTO ONLINE PERSONALIZADO ↪ javierpulido69gmail.com . Fitness Abs Cutting Gym BodyBuilding Fit Physique MensPhysique Bulking Muscle Protein Ripped Aesthetics IIFYM Motivation Inspiration Transformation Dedication WorkOut Healthy FitnessAddict InstaPic PicOfTheDay SixPack Yummy Gains Diet NoPainNoGain GymLife FitnessModel

1 Minutes ago
assane_ds

Assane DS

@assane_ds


Comment from Assane DS:


muscle aesthetics happy love bodybuilding fitness bodybuilder gym instagram determination shooting workout ifbb shredded fashion followme motivation follow nopainnogain fitfam training fitfrenchies healthy life gains nyc cute gymlifestyle instafit picoftheday

1 Minutes ago
corpoesaudenatal

whats(84)98899-9696 3223-8332

@corpoesaudenatal


Comment from whats(84)98899-9696 3223-8332:


Reabriremos a academia na próxima Quarta às 13h. Que tal aproveitar nosso Litoral nesse feriado r carnaval? Praia de Pirangi. Musculação + 33 Aulas Coletivas por semana(jump, Step, Abdominal, Zumba, Dança, Ginástica Localizada, Muay Thai e circuito Cardio). Tudo por 70 reais. Corpo e Saúde Academia. ❌❌❌❌❌❌❌❌❌❌❌❌❌ Musculação + 33 Aulas Coletivas por Semana por 70 reais. Melhor custo Benefício de Natal. ❌❌❌❌❌❌❌❌❌❌❌❌❌ exercise fit maromba nopainnogain lovegym health gym academia ❌❌❌❌❌❌❌❌❌❌❌❌❌❌ musculação jump step muaythai abdominal alongamento. corridaderua dança melhorcustobeneficio de natalrn corpoesaudeacademia fitness

1 Minutes ago
coach_timteam

Abdou Tim Tim

@coach_timteam


Comment from Abdou Tim Tim:


😉😉 coachTimbodypersonaltrainerfitspofitnessaddictedinstagramersinstagraminstagoodnopainnogaininstafitinstagramgymgymlifemcmwcwfitfamquotecleaneating healthychoicesgainznoexcusesgýmtimedreambigfollow4followfitfitnessmodelhealthycleaneatingaestheticcalisthenicsshredded

1 Minutes ago
vvdnvn_s

Thewoodcutter

@vvdnvn_s


Comment from Thewoodcutter:


Training hard 47 woodcutter football notredame marseille nopainnogain squadgoals dreamteam

1 Minutes ago
gyml1fe

▪▪▪ GymL1fe ▪▪▪

@gyml1fe


Comment from ▪▪▪ GymL1fe ▪▪▪:


Know the difference fools😂 - gymtime gymlife gym gymnastics gymrat selfie gainz mcm flex gainpost workout motivation nopainnogain justdoit focus fitspo ootd bodybuilding fitness instafit aesthetics aesthetic instafitness lifestyle fit fitfam fitfamily motivation fitnessmodel physique

1 Minutes ago
lucy_in_the_city

Lucie 👊🏻

@lucy_in_the_city


Comment from Lucie 👊🏻:


Tchin 🥂✨lilyinthefuckingvalley ❣️ . . . night instagood goals bodytransformation bodybuilding body bodygoals fit fitness fitnessmotivation fitnessgoals fitnessinspiration fitnessaddict fitnessjunkie fitnessjourney fitnesslife sport workout workoutmotivation motivation nevergiveup nopainnogain stayhealthy healthy healthylife stayfocused staypositive stayfit staystrong stayhumble

1 Minutes ago
joh_joh75

JOHANNA 👩🏼‍💻

@joh_joh75


Comment from JOHANNA 👩🏼‍💻:


Off to Puerto Rico ✈️

2 Minutes ago
authormohr

Michele Mohr

@authormohr


Comment from Michele Mohr:


Hiking! I can't feel my ass right now but I'm sure I will tomorrow. 😩nature nashville tennessee nopainnogain

2 Minutes ago
kevinrdz_17

† K|R †

@kevinrdz_17


Comment from † K|R †:


Entre más grande el reto, Mejor sabé la victoria. 🔝😝 nopainnogain

3 Minutes ago
_armando_p

_armando_p

@_armando_p


Comment from _armando_p:


I was sick for 3 days lost 5 pounds. But we are bouncing back 😂

4 Minutes ago
fitfitgoalfr

fitfitgoalfr

@fitfitgoalfr


Comment from fitfitgoalfr:


Plaisir de la semaine : croque monsieur avec pain de campagne et crème allégée ... délicieux !! instadaily instagram instafood regime fitgirl yummy fitfood regime regimeusemotivee regimeuse healthylife motivation nopainnogain bodygoal

1 Hours ago